PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK17372.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 282aa    MW: 30805.6 Da    PI: 4.7032
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK17372.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS241.14.5e-74862822203
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 +lLl+cAeavs++++  a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y+a+p+   ++++s++ ++a+++f+ +sP++kfsh+taNqa
  PK17372.1  86 LTLLLQCAEAVSADNFDDANKILLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGIYAAMPSVGVPQNHSQRMASAFQVFNGISPFVKFSHFTANQA 185
                579************************************************************************************************* PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
                I ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g+    s e+le+tg+rL++fA++lg+pfef + va+++ +l++e+L+v+++Ea
  PK17372.1 186 IQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGN----SMEALEATGKRLTDFADKLGLPFEFFP-VADKVGNLDPERLNVSKREA 280
                ************************************************....***************************.7******************* PP

       GRAS 202 la 203
                +a
  PK17372.1 281 VA 282
                98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.37959282IPR005202Transcription factor GRAS
PfamPF035141.6E-7186282IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
XFSPPLESSP NDQYLHWGGG AVLPPPPTPL PTSTATNTAD VIQQQQPENP SPVEEPVSVP  60
SPAVLLREKK EELRQQKRDE EGLHLLTLLL QCAEAVSADN FDDANKILLE ISELSTPFGT  120
SAQRVAAYFS EAMSARLVSS CLGIYAAMPS VGVPQNHSQR MASAFQVFNG ISPFVKFSHF  180
TANQAIQEAF EREERVHIID LDIMQGLQWP GLFHILASRP GGPPYVRLTG LGNSMEALEA  240
TGKRLTDFAD KLGLPFEFFP VADKVGNLDP ERLNVSKREA VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-27852824204GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010113028.11e-138hypothetical protein L484_022753
SwissprotQ2Z2E91e-123SCR_IPONI; Protein SCARECROW
SwissprotQ9M3841e-124SCR_ARATH; Protein SCARECROW
TrEMBLW9SCD51e-138W9SCD5_9R
STRINGPOPTR_0016s15060.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-125GRAS family protein